Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein (By similarity). Plays a role in limb regeneration.

256 amino acids

MDLVDSCQFSPSEFFYDSSSMPSPDDDFVEDFDSRLGRFRVHPDELQCSDEEEHVRAPSGHHQAGHCLLWACKACKRKSSTMDRRKAATMRERRRLKKVNSAFETLKRCTTANPNQRLPKVEILRNAISYIESLQELLREQVENYYTLPGQRCSEPGSPLSNCSDGMAECNSPAWSRRNGSFDSAYCSDIPTMYPTDKLSTLSSLDCLSSIVDRISSPEEPALPQQDNLTLSPSSSLESQLGTPDTPDPRPIYHVL

28.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MYF-5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here