Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.

591 amino acids

MADADKSEAAAGDDGSQQQPAEPRRDTHPGEPEKPPRSSANGVKMENDESVKEEKSDLKEKSTGNKKANRFHPYSKDKNSGTGEKKGPNRNRVFISNIPYDMKWQAIKDLMREKVGEVTYVELFKDAEGKSRGCGVVEFKDEEFVKKALETMNKYDLSGRPLNIKEDPDGENARRALQRTGTSFQGSHASDVGSGLVNLPPSILNNPNIPPEVISNLQAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMGTVTFEQAIEAVQAISMFNGQFLFDRPMHVKMDDKSVPHEDYRSHDSKTSQLPRGLGGIGMGLGPGGQPISASQLNITGVMGNLGPSGMGMDGPGFGGVNRIGGGVGFGGLEAMNSMAGFGGVGRMGELYRGAMTSSMERDFGRGDIGLSRGFGDSFGRLGSAMIGGFAGRIGASNMGPVGTGISGSMSGMSTVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDVDRGFLSGPMGSGMRDRLGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFESAESAEKACRIMNGIKISGREIDVRLDRNA

63.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Myef2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here