Catalyzes the transfer of acetyl from acetyl-CoA to desacetylmycothiol (Cys-GlcN-Ins) to form mycothiol.

Belongs to the acetyltransferase family. MshD subfamily.

303 amino acids

MKMIETSLASASAALRDRVDEILAAATREDGCAPLSESFLNGLRRADDGHVHSCVMDSHDQVVGVAARDGDSAEVVVDPAFRRQGYGSFLIRHVVSQGVKNVWAHGDGAGAKAVAKALQLEQTRQLLVMAVEGDRLVESAQLQVPSGFRVLALNEAYESIPDIEQQWLRVNNEAFEWHPEQGGWDSARLAQARDTQWFRESDVLFLIDTAKRTVAGFHWTKRHGDLAEGADGEVYVVGLGSAYRRRGLGDLLIRMGLHHLEYEHARRVILYVEGDNESARRAYDALGFHVVESHVTYSPQSSS

33.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mshD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here