Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (By similarity).

324 amino acids

MEGLSSKAQTMGREDDNRSSKMKVFHSELVYGDNHNISIKKADLTGQHKMMLLLSSALRIGSVHMDVSRILVKWCPYITPNMNTTIGITIKNNHHDDMSNINDMSTYISVKGKMSEALQITWHPASTLVYKKGMSCIFPWVVDVDTGSTEQESGSPALGEIKIWCYFKMQYHKPSTRHIARAEIAPSIEWGNTNFPYYVPFAMIRRARGIRPLDVFSTNQYSMFLEDVIKHVGTDSIKESDIVPIMSTMSQEDMMMINEKNKTCLLKRGGSYCSCKDVIENVVKEINMNRDRKYDNHGLLLSGYIAGSTSGRFQTVPMLSDISY

36.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sc4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here