Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (Potential). Also likely to act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that performs sequence-specific inhibition of viral mRNAs expression. Silencing activity has been seen in Nicotiana benthamiana and Nicotiana tabacum, two non-host plants.

108 amino acids

MCEPPPGFITVQCYTSDDLLTGDSTIVKSIPVRSCFFRQGVEVVLFRCESNKHRWSKIRGPVSLTVHCDICEFRETVVIPSLPKGFKVSSDFSYSVTWNCCYSRGRTE

12.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ORF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here