About Products Protein Database Contact

Protein expression services for ORF2 | Movement and silencing protein TGBp1

Description
Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Increases plasmodesma size exclusion limit. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (By similarity).
Family
Belongs to the Tymovirales TGBp1 protein family.
Species
White clover mosaic virus (strain M)
Length
236 amino acids
Sequence
MDHIHLLLSAHGFTRTRLAKSKPIVVHAIAGSGKSTVIRKILSDLPTPKAYTLGKPDPYSLSNPTIKAFAQFKRGTLDILDEYGQLPLTDLDSSFEFIFTDPYQAPTDNLFEPHYTLETTYRFGPNTCNLLNQAFQSNITSLVTKDNISFGSPYLVDPVGTILAFQPDTYLILCLHQASFFKVSDVIGYQWPTVTLYLACKISEIPEEERHLLFIGLTRHTESLLILGPDAFDSSP
Mass
26.4 kDa
Simulated SDS-PAGE
Western blot of ORF2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ORF2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here