Involved in ventralization. May mediate Bmp2b signaling during early phases of embryonic dorsal-ventral pattern formation. Required for initiation of Smad1 expression during gastrulation.

Belongs to the dwarfin/SMAD family.

464 amino acids

MTSMSSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEDLEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLEVCEYPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEFNPQHSLLVQFRNLSHNEPHMPLNATFPESFQQHSGGSSFPISPNSPYPPSPASSGTYPNSPASSGPSSPFQLPADTPPPAYMPPDEQMGQDGSQSMETGSSLAPQNMPRGDVQPVEYQEPSHWCSIVYYELNNRVGEAYHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDTSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEVHLHGPLQWLDKVLTQMGSPLNPISSVS

51.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make smad5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here