Promotes differentiation of dorsal tissues. May be involved in the mediation of Ndr2 signaling during mesoderm and axis formation during embryogenesis.

Belongs to the dwarfin/SMAD family.

468 amino acids

MSSILPFTPPVVKRLLGWKKSASGSSGAGGGGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNRNTKCVTIPSNCSEIWGLSTPNTIEQWDTSGLYSYPDQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAIETCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTNSIPENTNFPTGIEPPNNYIPETPPPGYISEDGEASDQQMNQSMDTGSPAELSPSTLSPVNHGMDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS

52.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make smad2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here