Lactone hydrolase that is required for the degradation of monocyclic monoterpenes such as menthol and carvone. Catalyzes the ring opening of lactones formed during degradation of monocyclic monoterpenes. Can hydrolyze epsilon-caprolactone, the lactone derivatives of dihydrocarvone (4R)-4-isopropenyl-7-methyl-2-oxo-oxepanone and (6R)-6-isopropenyl-3-methyl-2-oxo-oxepanone, and ethyl caproate.

Belongs to the 'GDXG' lipolytic enzyme family.

297 amino acids

MSATDTARAKELLASLVSMPDATIDDFRALYEQVCATFELPDDAQVEPVDANGADALWVSAPGVSADTVAVVVHGGGFTMGSAHGYRELGYRLSKSGNLRALVVDYRLAPESPFPAPVDDVVAAYRYARSLDGVENVFLVGDSAGGGIAMSALITLRDAGEQLPDAAVVLSPLVDLAGESPSLVDRAHLDPLPAAVLVNGMGGLYLNGLDVRHPVASPMHGDLTGLPATLVLVGTDEGLHDDSTRLVDKLKAADVEVQLEIGEGLPHIWPIFSFHPDAVAATDRIGEFLRSHVAAPR

31.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mlhB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here