Description
Monooxygenase; part of the gene cluster that mediates the biosynthesis of geodin, an intermediate in the biosynthesis of other natural products (PubMed:7665560, PubMed:19549600, PubMed:24009710). The pathway begins with the synthesis of atrochrysone thioester by the polyketide synthase (PKS) gedC (PubMed:12536215, PubMed:19549600). The atrochrysone carboxyl ACP thioesterase gedB then breaks the thioester bond and releases the atrochrysone carboxylic acid from gedC (PubMed:19549600). The atrochrysone carboxylic acid is then converted to atrochrysone which is further transformed into emodinanthrone (PubMed:24009710). The next step is performed by the emodinanthrone oxygenase gedH that catalyzes the oxidation of emodinanthrone to emodin (PubMed:1810248). Emodin O-methyltransferase encoded probably by gedA then catalyzes methylation of the 8-hydroxy group of emodin to form questin (PubMed:1444712). Ring cleavage of questin by questin oxidase gedK leads to desmethylsulochrin via several intermediates including questin epoxide (PubMed:3182756). Another methylation step probably catalyzed by methyltransferase gedG leads to the formation of sulochrin which is further converted to dihydrogeodin by the sulochrin halogenase gedL (PubMed:24009710). Finally, the dihydrogeodin oxidase gedJ catalyzes the stereospecific phenol oxidative coupling reaction converting dihydrogeodin to geodin (PubMed:7665560).
Family
Belongs to the avfA family.
Species
Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Sequence
MPKLVLLSSATLDEQLSRATPALIRWILLRSASHVYRDLVETEAFLRAQGDWVSTVFIKPGGLSLDVQRGHALSLTEEKSPLSYADLAAAMIEAATDPDGRWDMRNVGVISVNGPAKSPPGAPMCIFMGFVRHYFPFLHPYLPSTGPG
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service