Description
Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin.
Family
Belongs to the MoaD family. MOCS2A subfamily.
Species
Chlamydomonas reinhardtii
Sequence
MQIKVLYFAKSREVAGVNEQTFELGDGAHTEDLLAQIIAAHPALDSVMKTCVFALNQEYVRPQDKEALKDGDEVAIIPPLSGG
Simulated SDS-PAGE
![Western blot of CHLREDRAFT_109356 recombinant protein](/recombinant/CHLREDRAFT_109356-1.png)
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service