Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.

Belongs to the MoaE family. MOCS2B subfamily.

367 amino acids

MDHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVVSLAYEAYDSMALKEMNKICSDLRSKWPDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKEIYEGDYDSEWKENKESIRPKKSQSAFNYAACPCKVEESHDVPRTLVQIRVNDAELTKRLECFVNRKRDEINSQNVIDFKSSFVNSDKDFSDSCARTQSTIIKQEQSNSHLKVRRVNNRCGPQQMEMRPNYELELNKLMGSRDGQTDPSKEMRKSLPNSRLQAIESYMCLTTDNEENIFSRIKKVENRLLQLESISPEYRHFTKLEPSSMEPPPPKKIRKKSYSAQELSAFIQKIKDGSEFT

42.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mocs2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here