This methylase recognizes the double-stranded sequence GGATCC, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BamHI endonuclease.

Belongs to the N(4)/N(6)-methyltransferase family.

423 amino acids

MRFFSVFDIVKNKANQLGYTETEMYAVLKNYNVNKKDLLAYKENGVIPTDKVLNGILSYLGMTKVELELKLGRIPAGLEDVFLNNTKEIAKILENKNSVKLNEFNSIQEIKPYFYTDLGKLYNGDCLELFKQVPDENVDTIFADPPFNLDKEYDEGVTDKNSFSGYLDWYYKWIDECIRVLKPGGSLFIYNIPKWNTYLSEYLNRKLNFRNWITVDMKFGLPIQNRLYPANYSLLYYVKGDKPKTFNVQRIPLQTCPHCGREIKDYGGYKNKMNPKGVTLSDVWSDIYPVRHSSSKNRKFNELSVKLLDRIITMSTNEGDVVLDPFGGSGTTFAVSEMLGRKWIGFELGNCEIIKERLKNKDKDKKLLGKVYEEKNKLFPNRVKELRKKNGLWIDDDFRQDHEGNSKGDKKNENNDQISLSLE

49.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make bamHIM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here