MKK3-MPK6 module plays an important role in the jasmonate signal transduction pathway through the negative regulation of MYC2/JIN1 expression. Activates by phosphorylation the downstream MPK6, MPK7 and MPK8. MKK3-MPK7 module acts as a positive regulator of PR1 gene expression. MKK3-MPK8 module negatively regulates ROS accumulation through controlling expression of the RBOHD gene. Component of the abscisic acid (ABA) signaling pathway that may act as ABA signal transducer in the context of abiotic stresses. Activator of the C group MAP kinases. Activates MPK7 in response to ABA (PubMed:25720833).

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.

520 amino acids

MAALEELKKKLSPLFDAEKGFSSSSSLDPNDSYLLSDGGTVNLLSRSYGVYNFNELGLQKCTSSHVDESESSETTYQCASHEMRVFGAIGSGASSVVQRAIHIPNHRILALKKINIFEREKRQQLLTEIRTLCEAPCHEGLVDFHGAFYSPDSGQISIALEYMNGGSLADILKVTKKIPEPVLSSLFHKLLQGLSYLHGVRHLVHRDIKPANLLINLKGEPKITDFGISAGLENSMAMCATFVGTVTYMSPERIRNDSYSYPADIWSLGLALFECGTGEFPYIANEGPVNLMLQILDDPSPTPPKQEFSPEFCSFIDACLQKDPDARPTADQLLSHPFITKHEKERVDLATFVQSIFDPTQRLKDLADMLTIHYYSLFDGFDDLWHHAKSLYTETSVFSFSGKHNTGSTEIFSALSDIRNTLTGDLPSEKLVHVVEKLHCKPCGSGGVIIRAVGSFIVGNQFLICGDGVQAEGLPSFKDLGFDVASRRVGRFQEQFVVESGDLIGKYFLAKQELYITNLD

57.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MKK3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here