The CERK1, MEKK1a/b, MKK1a/b/c and MPK4a/b proteins are involved in pathogen defense. The pathway induces rapid growth inhibition, cell wall depositions and accumulation of defense-related transcripts. This protein is required for full defense response to fungal pathogen chitin.

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.

352 amino acids

MRRARGKFKGGNSALRVNVPKENAISDYVTASGTFQDGDIMLNKEGIRVVSQTQTSTPAANGNISLSDLETVKVLGKGSGGVVQLVRHKWTNETYALKVIHMNIEETTRKQIVQELKINHASQCPYVVICYHAFYNNGLISIVLEYMDGGSLADIMKELEPKCIKEPNLGVVCKQVLLGLMYLHQTRHIIHRDIKPSNLLVNHKGEVKISDFGVSAVLANSMAVRDTFVGTCTYMSPERVLGGTYGFDSDIWSLGLTLLECALGKYPYQPPGSEEGWMNFYELLQTIVDQPPPVAPADQFSPEFCSFISACLQKDPKCRPTAAELLNHPFVNKYDEEEYGLAKLLPPLVPLA

39 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MKK1a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here