UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

310 amino acids

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGESKIPVNTGHGPVKYRGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSRLMAGCTTGAMAVALAQPTDVVKVRFQAQNSAGANKRYHGTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSAPGQYCSALNCAVAMLTKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMMAARHNWATPL

33.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ucp2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here