Mitochondrial transcription factor that confers selective promoter recognition on the core subunit of the yeast mitochondrial RNA polymerase. Interacts with DNA in a non-specific manner (By similarity).

Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family.

335 amino acids

MTKSSFLKSVLPLANKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLIQSVILNERLKPKKHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHNEFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLPDCIEKFDPVIIPSDNKSPDDLSLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRLDPVLLKKKPYELTYLEIDEIAKVFALWPFKPSLLVDFYDENED

39.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MTF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here