Plays a role in the regulation of lifespan in a partially daf-16-mediated manner, and may be involved in regulating the levels of reactive oxygen species production in response to heat stress.

269 amino acids

MMVSPPQEDTVFNTDSDPVYEQATDDMTFNDTTTDGNGQESVPLEALTVVEIEKTSKGFGFNIVGGTDNPHFVGDIGIYVSSVNSESKSYGVVRTGDKILSFDGIDMTYKTHDEAVEVFRSVKIGHVAKMLIDREYLHLQEDRTQTPTASVSITPQVTPQTRSTQNNTDTPKSMSHSESKSRLTSHGLSAVIERIRGKVYEEEDAQSVTSYAPSTHSIIDDVPRTPRKPLSLLDPRNNSWLTEALYVSIGLGALTISGYLAYRFIRGRR

29.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mics-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here