Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17 or MICU1. Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria.

139 amino acids

MSYCRQEGKDKIIFVTKEDHETPSSAELIADDPNDPYEDHGLILPNGDINWNCPCLGGMASGPCGEQFKSAFSCFHYSQEEIKGSDCLDQFRAMQECMQKYPDIYPQEDDEDEAEKEKQNKEAEAFSTETSDTKEESSS

15.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make chchd4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here