Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to stimulate activity of mtHSP70 (hsp70-5) (By similarity).

Belongs to the TIM14 family.

105 amino acids

MSSAVAIGAGVAVAAFLGRAGLVAWRRSRGGVGALGKAFYKGGFEPRMNKKEASLILSLNERTITKDKIRKAHRTLMLLNHPDRGGSPYLATKVNEAKEFLEKSV

11.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tim14 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here