About Products Protein Database Contact

Protein expression services for timm9 | Mitochondrial import inner membrane translocase subunit Tim9

Description
Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).
Family
Belongs to the small Tim family.
Species
Xenopus laevis
Length
89 amino acids
Sequence
MAAQMSESDQIKQFKEFLGTYNKLTENCFLDCVKDFTTREVKAEEMTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Mass
10.4 kDa
Simulated SDS-PAGE
Western blot of timm9 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make timm9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here