About Products Protein Database Contact

Protein expression services for Timm29 | Mitochondrial import inner membrane translocase subunit Tim29

Description
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. Required for the stability of the TIM22 complex and functions in the assembly of the TIMM22 protein into the TIM22 complex. May facilitate cooperation between TIM22 and TOM complexes by interacting with TOMM40.
Species
Mus musculus
Length
266 amino acids
Sequence
MVTAALKRFWSGGHGEAGGEAGGATTVAVKPGLWTRLSTWAGALLRDYAEACGDAAAAARARPGRAALYVGLLGGAAACCALAPSEAAFEEALLDASGSLLLLAPATRNRHSEAFLQRLLWLRGRGRLRHVNLGFCSLVYEAPFDAQASLYQARCRYLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR
Mass
29.4 kDa
Simulated SDS-PAGE
Western blot of Timm29 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Timm29 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here