Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

117 amino acids

MDSNLRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVDVQTTINAKRMEEMEENARKAEQQQREQEKERLKEAAATAVLTPVQPPVAGNLSM

13.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Tim9b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here