Protein expression services for TIM54 | Mitochondrial import inner membrane translocase subunit TIM54
Description
Essential component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as external driving force (By similarity).
Family
Belongs to the TIM54 family.
Species
Candida albicans (strain SC5314 / ATCC MYA-2876)
Length
400 amino acids
Sequence
MPDANEVKPKKGWSNPALRMMGIPRISLPSRNWMIFWTVVTTIGGGIAYDKYEQKQMRKKWMDAVKQFGEVSYGANEIPRKLSIFIAPPPNDFLDESLKLFRKFIKPVLNAGVVDFEIFSESRQGDIRASVAEKIRELRRKQLVEETPKKNESNGNQDNDEEELKSRSDLYKAKDVLGLYKVFPADINVKSEDAIDDSSAGGIICVGRGAYKEYLSGVHEGLLGPLEKPQSVIDEETKLAEEKKKEKEENPDKDDDNDEEQSNLKPVPLRYIKPEDYANAQLAPELDLSTVVKDDKGVPVFFEQPVYTFPLPNLVGFTNIPRKIYRYFTKRFLVDDFGERTATIVNNKSRPFVYKDVLMAKEEEMDWPKKWVEKGKERNSEWVQELEHDERVTSRMKVFE
Mass
46.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make TIM54 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here