Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Has some phosphatase activity in vitro; however such activity may not be relevant in vivo.

Belongs to the TIM50 family.

353 amino acids

MAASAALFSRLRSGLRVGARGLCTRLAPPPPRTPEQVTEIANRGGSKAQGPQHQPGSEGPSYAKKIALWIAGLLGAGGTVSIVYIFGNNPVDENGTKIPDEFDSDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLREPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMEGHHVKDISCLNRDPARVVVVDCKKEAFRLQPFNGVALRPWDGNSDDRVLLDLSAFLKTIALNQVEDVRTVLEHYALEDDPLEAFKQRQSRLEQEEQQRLAELSKSNRQGLSFGSLASRLWPRSKQP

39.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Timm50 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here