About Products Protein Database Contact

Protein expression services for TIM22 | Mitochondrial import inner membrane translocase subunit TIM22

Description
Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps (By similarity).
Family
Belongs to the Tim17/Tim22/Tim23 family.
Species
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Length
187 amino acids
Sequence
MSIPLPSAMPLLPPIYLPGQEPLPAGTSDWERQEMQTALKYQRYMGMVMESCPLKVTIAGVGGLAIGGFFSLMSATFAYEDPLSRASNKLTTTRAQTMFVFKEMGRNMWSSGRGFAKVGMVYSGVECCIEGYRAKNDIYNGVSAGFLTGAILARNAGPTAMLGGGVAFAAFSGAIDWWLRSAPADEI
Mass
20.1 kDa
Simulated SDS-PAGE
Western blot of TIM22 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make TIM22 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here