Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to keep the TOM and the TIM23 complexes in close contact. At some point, it is released from the TOM23 complex to allow protein translocation into the mitochondrial matrix (By similarity).

Belongs to the TIM21 family.

268 amino acids

MHMIQRVSSIGLRTLRSSNIGSIRSLIVLPILSIKPTYIRQTQAQINLKPQALLLNLLLHHHHHHHHYYSTKTAPPPPPPPQPPQDKNAKGKKILNRINRAFTFSLSTLLVVGAAGISVLVVSLILSELFLPSGDTRTFNKAVKLIEKNEQAQKALNFQSGQRLKAYGIVSADKWVRNRPVQSVKTKRKDGKDHLIMKFQVESDNGKYGVVSLEQIDNSMWNTEFEYISLDVPGFKRIYIIEPPKNQLIPKIGGGSGFLGLNWGPKKD

30.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TIM21 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here