Protein expression services for CHGG_05907 | Mitochondrial glycine transporter
Description
Mitochondrial glycine transporter that imports glycine into the mitochondrial matrix. Plays an important role in providing glycine for the first enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) in the mitochondrial matrix.
Family
Belongs to the mitochondrial carrier (TC 2.A.29) family. SLC25A38 subfamily.
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Length
333 amino acids
Sequence
MSDGSRTALSKSTFHFAAGLGSGVLSAVLLQPIDLLKTRVQQSGAHSLSAAIADIRAAPRLLPALWRGAVPSALRTGFGSAIYFTSLNAIRQSAARISPLPSSSSSTTTSSSTTTSSSSSSLPKLSNTSNLLAGAAARSLAGLILMPLTVLKVRYESTLYNYTSLASAARDIAAHEGARGFFAGYGATAVRDAPYAGLYVLFYEQGKKRLSQLFPTTTTTTTTNSTQNGPMGLQHAASINFASGVLAGVICSVVSNPFDAVKTRIQLQPGRYRNMVSGARRMVGEEGVRALWDGLALRMSRKAVSSALAWTVYEELIRRAEAGWRAGAARERL
Mass
35.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CHGG_05907 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here