Plays a role in the catabolism of L-fucose, a sugar that is part of the carbohydrates that are attached to cellular glycoproteins. Catalyzes the dehydration of L-fuconate to 2-keto-3-deoxy-L-fuconate by the abstraction of the 2-proton to generate an enediolate intermediate that is stabilized by the magnesium ion. May down-regulate thymidylate synthase activity, possibly already at the RNA level, by promoting the degradation of TYMS mRNA via an antisense RNA-based mechanism.

Belongs to the mandelate racemase/muconate lactonizing enzyme family. ENOSF1 subfamily.

445 amino acids

MITGKITCLHITDVRFPTSLDQHGSDAMHTDPDYSAAYVVIETDAADGLKGHGLTFTLGKGTEVVVCAVRALSRHVIGKALEDIVNNFRDFYRQLTSDGQLRWIGPEKGAVQLATAAVLNAVWDLWAKKEKKPLWKLLVDMDPHQLVSCIDFRYITDALTEEEALKILQNGKQGQRDREEHMLTSGYPAYTTSCAWLGYSDEQLKKLCSDALKEGWTRFKVKVGADLKDDIRRCELIRDMIGPDNIMMLDANQRWDVQEAISWVKDLAKYKPLWIEEPTSPDDILGHATISKELSPVNIGVATGEQCHNRVMFKQFLQAKALQYLQIDSCRLGSVNENLSVLLMAKKFNVPVCPHAGGVGLCELVQHLILFDYICVSGSLDNRMCEYVDHLHEHFTYPVIINRAAYMPPKDPGYSTEMKEESVLQYQFPDGAVWKKLILEKKVEV

50.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make enosf1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here