Description
Plays a critical role in PIWI-interacting RNA (piRNA) biogenesis (By similarity). piRNAs provide essential protection against the activity of mobile genetic elements. piRNA-mediated transposon silencing is thus critical for maintaining genome stability. Backbone-non-specific, single strand-specific nuclease, cleaving either RNA or DNA substrates with similar affinity (By similarity). Produces 5' phosphate and 3' hydroxyl termini, suggesting it could directly participate in the processing of primary piRNA transcripts (By similarity). Has been proposed to act as a cardiolipin hydrolase to generate phosphatidic acid at mitochondrial surface. Although it cannot be excluded that it can act as a phospholipase in some circumstances, this activity could not be confirmed (By similarity).
Family
Belongs to the phospholipase D family. MitoPLD/Zucchini subfamily.
Species
Chlamydomonas reinhardtii
Sequence
MGCASSKEEVALTPLSDVNAAKEVADLKAQVDQLKRQLASAGQSAAPAAAGAVKGGVVETLFFPDEKLPCRNNRRPGGCKRQHCEYSHTPTSLSRFLDYLGSATRTLDICVFTITNDDISDVVLELHNKGVRVRIISDNDQAHTQGSDIDKFRQAGIAVRQDKTAAHMHHKFAIIDGRLLLNGSFNWTRQAVTANNENVTVLSDPKLIASFQQQFDKLWDMFK
Simulated SDS-PAGE
![Western blot of CHLREDRAFT_190403 recombinant protein](/recombinant/CHLREDRAFT_190403-1.png)
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service