Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).

Belongs to the SPOT14 family.

183 amino acids

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLSEPDLDNEVSVEVGGSGSCLEERTTPAPSPGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPSSPPAGSEEGTWKPKDILVGLSHLESTDAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFSNWGH

20.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mid1ip1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here