Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes.

Belongs to the MAPRE family.

269 amino acids

MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGSVYCQFMDMLFPGSVVLKKVKFQAKLEHEYIQNFKVLQAGFKKMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQESAPVPVLAAPVLNKPKKPLGSGNTAPQRTVPVQRTAVSNKPPAQGISKKPATVGNGDDESAELIQQINVLKITVEDLEKERDFYFGKLRNIELICQENEGESDPVLQRIIEILYATDEGFVIPDEGAPPEDQEEY

30.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mapre1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here