Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). Functions in the methionine salvage pathway. May play a role in apoptosis.

Belongs to the aldolase class II family. MtnB subfamily.

242 amino acids

MAAASGHGLELANGGDATQDKLHPRNLIPELCRLFYGLGWVTGTGGGISLKHGNEIYIAPSGVQKERIQPEDMFVCDMNEQDISGPPAHKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLYPGNEFTITHQEMIKGIQKCSSGGYYRYDDTLVVPIIENTPEEKDLKERMAKAMEEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVQMKQHGLDPSKHPAGENGIL

26.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make APIP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here