Protein expression services for ogt | Methylated-DNA--protein-cysteine methyltransferase
Description
Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
Family
Belongs to the MGMT family.
Species
Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)
Length
148 amino acids
Sequence
MICSQYGPVVVGWDGSKTFVNPSRCSKRVGLAEFLELINIDEIDKRLLYLLGIPRGYVTTYKLYAEVLGTSPRHVGWLMARNPLPVILPCHRVVKSDFSLGGYTGGVEVKKKLLAYEGALCGDRPCRVVRPRMIDDVRDALFKSLGLA
Mass
16.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ogt using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here