Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Belongs to the MGMT family.

172 amino acids

MLTYKTFKILGREILIGVVWEEKIQGIAYSLDGLEFLKDQLSRVTSHLKSRGVKVNLLEEKSRYPDLVFDVLKGKIGNEKGFEELSLEGLTRFEIKVYSWLVKNVKRGEVITYGKVAKALKTSPIAVGGAMKRNPYPIIVPCHRVVGKNNPWLYTPKPSYKKFLLEVEGWIS

19.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ogt using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here