Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

175 amino acids

MARLLRALRGLPLLQAPGRLARGCAGSGSKDTGSLTKSKRSLSEADWQKKLTPEQFYVTREKGTEAPFSGMYLNNKETGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAYGSKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPKPTGQRFCINSVALKFKPSKP

19.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Msrb2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here