Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Acts as a regulator of actin assembly by reducing methionine (R)-sulfoxide mediated by MICALs (mical1, mical2 or mical3) on actin, thereby promoting filament repolymerization. Plays a role in innate immunity by reducing oxidized actin, leading to actin repolymerization in macrophages.

Belongs to the MsrB Met sulfoxide reductase family.

110 amino acids

MSFCSFSGGEIYKDHFESGMYVCAQCGYELFSSRSKYEHSSPWPAFTETIHEDSVSKQEERWGAYKVRCGKCGNGLGHEFVNDGPKHGLSRFUIFSSSLKFIPKVKNEQQ

12.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make msrb1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here