Probably involved in maturation of some viral proteins by processing them preferentially at Ala-Gly-|-Ser/Thr/Lys motifs. Does not seem to be responsible for the cleavage of major core proteins (By similarity).

Belongs to the peptidase M44 family.

591 amino acids

MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDEILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSATESDAIRTLVSWFFSNGKLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPSSIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAILQISQCQRINMNYSDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVLDATNDGLIKKPYRSIPLMKRLTSNEIFIRYGDASLMDMITLSLSKQDISLKRNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEFSKKTKSKILFGRNARYDVTTKSSFVCGIVRGKLLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKGDVENFSSLKKDVVIRV

68 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make G1L using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here