Component of the respiratory Qrc complex, that catalyzes the reduction of the menaquinone pool using electrons transferred from the reduced periplasmic cytochrome c3, and which is probably involved in sulfate respiration. Is likely essential for growth on H(2) or formate since the periplasmic hydrogenases and/or formate dehydrogenases act as primary electron donors for the Qrc complex. QrcC is an electron-transferring subunit; its cubane iron sulfur clusters form a pathway for electron transfer between the hemes of QrcA and the membrane quinone pool.

255 amino acids

MSSFKEFKIKWGMVIDLDKCTGCGACMVACQAENNIAPQPDASNKLKSLNWLVVYELNNGKPFPEHDVAYLPRPCMQCGKPSCVSVCPVVATDKNEEGGIVSQVYPRCIGCRYCMASCPYHARYFNWFDPTWPEGMDKTLTPDVSVRPRGVVEKCTFCHHRFMQAKDKARVEGRDPSALRDGDYVTSCTEACPNGAIIFGDFNNPEHRVHELHKSKYAFRLLERLGTDPQVYYLSRREWVRRLGDNYLEHEKVKG

29 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make qrcC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here