Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

494 amino acids

MRIMAVRLVAGAITLALMAYAWLAWERARDPEPITILERVLERGELRVITRISATTYYQTDKGRAGLEFELAQAFAHRLGVQLRMLVAPDLEAIFAALDDGEADLAAAGLTYTESRGQRYWFTPPYKDITQQLVYRVGTPRPDDLSEIGPGELAVIANSSHADRLRELRNRSHPDLTWAEDEHADSEAMLYRVWNEELRYTVADSHELSINRAYYPELRKAFEISGVEGLAWAFPRTEDLSLYNEAARYFTDLRLEGTLSTLLEEHFGHLGRFDYVGFRAFNRHVADRLPRYRHWFEEAAEEYGVDWRLLAAIGYQESHWDPQAVSPTGVRGIMMLTLDTASMLGVDNRLDPKQSIFGGARYFSRLLERLPEDIEEPHRAWMALAAYNVGYGHLQDARRLARQRGYDPNDWRVIRDHLPLLSQRQWYVQTRHGYARGWEPVHYVRNIRLYYQLLQRITEPGRRQVPAGEALGEPPLPTPPAPPGAPLPADPPAD

56.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mltF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here