About Products Protein Database Contact

Protein expression services for yidC | Membrane protein insertase YidC

Description
Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins.
Family
Belongs to the OXA1/ALB3/YidC family. Type 1 subfamily.
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Length
557 amino acids
Sequence
MDIKRTVLWVIFFMSAVMLFDNWQRSHGRPSMFFPNVTQTNTASNATNGNGASGASAAAANALPAAATGAAPATTAPAAQAQLVRFSTDVYNGEIDTRGGTLAKLTLTKAGDGKQPDLSVTLFDNAANHTYLARTGLLGGDFPNHNDVYTQAAGPTSLAAGQNTLKLAFESPVKGGVKVVKTYTFTRGSYVIGVDTKIENVGTAPVTPSVYMELVRDNTSVETPMFSHTFLGPAVYTDQKHFQKITFSDIDKNKADYVTSADNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDPTLYRVGVKQPVAAIAPGQSADVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFILPVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYITRTLGAAAAKKKAS
Mass
61.1 kDa
Simulated SDS-PAGE
Western blot of yidC recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make yidC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here