Photoreceptor implicated in non-image-forming responses to light. May be able to isomerize covalently bound all-trans retinal back to 11-cis retinal (By similarity).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

475 amino acids

MGTQHRIKVDVPDRVLYTVGSCVLVIGSIGITGNLLVLYAFYSNKRLRTPANYFIMNLAASDFLMSATQAPICFLNSMHTEWILGDIGCNFYVFCGALFGITSMMTLLAISVDRYCVITKPLQSIKRSSKKRSCIIIAFVWLYSLGWSVCPLFGWSSYIPEGLMISCTWDYVSYSPANRSYTMMLCCFVFFIPLIIIFHCYLFMFLAIRSTGRNVQKLGSTYNRKSNVSQSVKSEWKLAKIAFVAIVVFVLSWSPYACVTLIAWAGYAKTLNPYSKSVPAVIAKASAIYNPIIYAIIHPRYRRTIRSAVPCLRFLIRISPSDLSTSSVNESSFRASMSSRHSFAARNKSSCVSSISAAETTWSDMELEPVEAARKKQQPHRSRSFSKQAEEETGLLLKTQSCNVLTGEKVAVSSISLHDPFERSFGENAPELLLRPSCLRTSSLPFGLNSSSTEENADTSDMEVQEQHQMEASSH

53.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OPN4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here