Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. This receptor is a possible mediator of the immunomodulation properties of melanocortins.

Belongs to the G-protein coupled receptor 1 family.

325 amino acids

MNSSSHLTLLDLTLNASEDNILGQNVNNKSSACEDMGIAVEVFLTLGLVSLLENILVIGAIVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETITIYLINNKHVVIADTFVRHIDNVFDSMICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIYYESKYVIVCLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRASMKGAITLTMLLGIFIVCWSPFFLHLILMISCPQNVYCACFMSYFNMYLILIMCNSVIDPLIYALRSQEMRRTFKEIICCHGFRRTCTLLGRY

37.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mc5r using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here