Meiosis-specific activator of the anaphase promoting complex/cyclosome (APC/C). Involved in cdc13 degradation.

Belongs to the WD repeat CDC20/Fizzy family.

421 amino acids

MGDRFIPIRNVSNEFNFSFQSFKECVLSHGSNLRRKTSGTIQRQFMELLSMELFGSQASRSRAFYYGEDKRKIEKKMLDTPDRKSYSLSPISPQSQDMLRQPQKPKRAFPKTPYKILDAPYLKNDFYLNLLDWGQSNVLAVGLASSIYLWSAASGKVVQLHDFGATNHVTSVLWTGKGTQLAVGTDSGVIYIWDIESTKSVRSLKGHSERVAALAWNDNTLTSGGKDEVILHHDLRAPGCCAEMMKVHEQEICGLQWDRSLGQLASGGNDNNLFVWDYRSSRPLHKFEEHTAAVKAIGWSPHQRGILASGGGTIDRCLTIHNTLTGRLQNKLDTGSQVCNMAWSKTSNEIVTTHGFAKNQVSLWKYPSLKNIANLTAHTNRVLYLSMSPDGQSIVTGAGDETLRFWKLFNKKPKEESTLIR

47.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mfr1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here