Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

single

273 amino acids

APRWVYHLTSAWMVFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLVETIIASTISVVNQMYGYFVLGHPLCVVEGYTASLCGITGLWSLAIISWERWMVVCRPFGNVRFDAKLAIAGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCFIPLSVIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAFCLCWGPYAFFACFAAAHPGYAFHPLVAALPAYFAKSATIYNPI

30.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OPN1MW using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here