Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).
Family
Belongs to the Mediator complex subunit 7 family.
Sequence
MGEPQQVSALPIPPMQYIKEYTDENIRKSLAPKPPVPIKDSYMMFGNQFQCDDLIIRPLETQGIERLHPVQFDHKKELRKLLMSILVNFLDMLDILIRSPGSIRREEKLEDLKLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVVEMIQNCLASLPDDLPLPDGTVSVKTEPMDVQEPCTDHHEGPQGAAASVKEATIDKDAAMCGIIDEMT
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service