Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors.
Family
Belongs to the mediator complex subunit 32 family.
Species
Arabidopsis thaliana
Sequence
MDNIVDSLNKAYEKFVLASAGVLESKESAGGQKALLTDTALENFKEKWELFRVACDQAEEFVESVKQRIGSECLVDEATGLTTTAAGGQAPAAVTGAATSLPPISAVRLEQMSRAVRWLVLELQRGSGVAPGSVHSSSTGFDSRFSEDSTQ
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service