Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for activated transcription of the MtnA gene.

Belongs to the Mediator complex subunit 20 family.

252 amino acids

MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETFISTPQPHNGAPGRAVHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKLGSVTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQLHAKHNDIFEPMDTVKQYLEQFTNYRKHVTLMGGMGSGPGSQQVGPNVHMSPAVAGLHRS

27.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MED20 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here