About Products Protein Database Contact

Protein expression services for NUT2 | Mediator of RNA polymerase II transcription subunit 10

Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).
Family
Belongs to the Mediator complex subunit 10 family.
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Length
133 amino acids
Sequence
MSTEASTGETPEFQSYDHRGSPTQEAMKREIQSLIQNLVKLSRTAPAIHVLIPPEIVMYVEGSRNPDIYNREFVETVQRMNQMLKGRSEALQALQAQIAHQLQIAIPEMKDDIERAVEATGGKVPITGITLDP
Mass
14.8 kDa
Simulated SDS-PAGE
Western blot of NUT2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make NUT2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here