Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation (By similarity).

206 amino acids

MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHHSPGTVCRRRKAPLQAPGALNSGRHVHNELEKRRRAQLKRCLEQLRQQMPLGVDHTRYTTLSLLRGARMHIQKLEEQEQQAQRLKEKLRSRQQSLQQQLEQLQGLLGVRERDRLRADSLDSSGLSSERFDSDQEDLEVDVESLVFGTETELLQSFSAGQEHSYSHSTGTWL

23.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mxd3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here